- Recombinant Succinate dehydrogenase cytochrome b560 subunit (SDH3)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1001151
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 16,724 Da
- E Coli or Yeast
- Succinate dehydrogenase cytochrome b560 subunit (SDH3)
- 1-144
Sequence
MISINFNFLKIKGIINMNINRPISPHLTIYKLQITNTLSIFHRITGGVLALTLCFFILILKMLNFHLSSYAFYSIAYTLNQYSGFLFIAISFFLLLFIFYHLFAGLRHLVWDAGYALEIENVYLTGYIMLGLAFLFTLIAWIIF